|
|
NetOGlyc 3.0 Server - prediction resultsTechnical University of Denmark |
WARNING: This sequence may not contain a signal peptide!! Proteins without signal peptides are unlikely to be exposed to the O-glycosylation machinery and thus may not be glycosylated (in vivo) even though they contain potential motifs. SignalP-NN euk predictions are as follows: name Cmax pos ? Ymax pos ? Smax pos ? Smean ? Sequence 0.211 35 N 0.087 35 N 0.367 60 N 0.082 N SignalP output is explained at: http://www.cbs.dtu.dk/services/SignalP/output.html Name: Sequence Length: 261 ASHLPYIEQGMQLAEQFKQKAIGLLQTATKQAEAAAPVVESKWRTLEAFWAKHMWNFISGIQYLAGLSTLPGNPAIASLM AFTASITSPLTTQHTLLFNILGGWVAAQLAPPSAASAFVGAGIAGAAVGSIGLGKVLVDILAGYGAGVAGALVAFKVMSG EMPSTEDLVNLLPAILSPGALVVGVVCAAILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQILSSL TITQLLKRLHQWINEDCSTPC ................................................................................ ................................................................................ ................................................................................ ..................... Name S/T Pos Score Y/N Comment -------------------------------------------------------------------- Sequence S 2 0.346 . - Sequence T 27 0.341 . - Sequence T 29 0.335 . - Sequence S 41 0.260 . - Sequence T 45 0.268 . - Sequence S 59 0.136 . - Sequence S 68 0.190 . - Sequence T 69 0.284 . - Sequence S 78 0.354 . - Sequence T 83 0.494 . - Sequence S 85 0.286 . - Sequence T 87 0.336 . - Sequence S 88 0.230 . - Sequence T 91 0.317 . - Sequence T 92 0.327 . - Sequence T 95 0.298 . - Sequence S 113 0.296 . - Sequence S 116 0.336 . - Sequence S 130 0.170 . - Sequence S 159 0.229 . - Sequence S 164 0.251 . - Sequence T 165 0.370 . - Sequence S 177 0.208 . - Sequence S 213 0.218 . - Sequence S 219 0.292 . - Sequence T 221 0.412 . - Sequence S 227 0.385 . - Sequence T 234 0.369 . - Sequence S 238 0.191 . - Sequence S 239 0.188 . - Sequence T 241 0.205 . - Sequence T 243 0.196 . - Sequence S 258 0.286 . - Sequence T 259 0.379 . - --------------------------------------------------------------------
Explain the output. Go back.