The ELM Server

Currently 113 Elms in ELM database.

Your sequence:

Name: unknown Length: 630
MASLCSNSSSTSLKTPFTSSTTCLSSTPTASQLFLHGKRNKTFKVSCKVTNTNGNQDETNSVDRRNVLLGLGGLYGVANA
IPLAASAAPTPPPDLSSCNKPKINATTEVPYFCCAPKPDDMSKVPYYKFPSVTKLRIRPPAHALDEAYIAKYNLAISRMK
DLDKTQPDNPIGFKQQANIHCAYCNGGYSIDGKVLQVHNSWLFFPFHRWYLYFYERILGSLIDDPTFGLPFWNWDHPKGM
RFPPMFDVPGTALYDERRGDQIHNGNGIDLGYFGDQVETTQLQLMTNNLTLMYRQLVTNSPCPLMSLVDLTLFGSTVEDA
GTVENIPHSPVHIWVGTRRGSVLPVGKISNGEDMGNFYSAGLDPLFYCHHSNVDRMWNEWKATGGKRTDIQNKDWLNSEF
FFYDENGNPFKVRVRDCLDTKKMGYDYHATATPWRNFKPKTKASAGKVNTGSIPPESQVFPLAKLDKAISFSINRPASSR
TQQEKNAQEEVLTFNAIKYDNRDYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDPKHTATATLRLAITELLE
DIGLEDEDTIAVTLVPKKGDISIGGVEIKLAIVKLVCVVNLLTLQLNKDRFCYDSVFVCWFVCLFFNFHV

No user supplied cellular location.
User supplied taxon: Lycopersicon esculentum

Elms Instances
retained 14 56
Species filtered 22 76
Smart filtered 0 0
Cellular location
filtered 0 0
all found
(before filtering) 36 132

Globular domains/ Signal & TM sequences found by the SMART server

Domain

Start

End

Results of ELM motif search after globular domain filtering and context filtering.

All matches falling inside SMART/PFAM domains are excluded from this list.

Elm Name	Instances (Matched Sequence)	Positions	Elm Description	Cell Compartment	Pattern
LIG_14-3-3_3	KVNTGS KAISFS	447-452 467-472	Consensus derived from natural interactors which do not exactly match the mode1 and mode2 ligands	nucleus, cytoplasm, plasma membrane	[RHK][STALV].[ST].[PESRDIF]
LIG_CYCLIN_1	KVLQV RQLV	193-197 294-297	Substrate recognition site that interacts with cyclin and thereby increases phosphorylation by cyclin/cdk complexes. Predicted protein should have the MOD_CDK site. Also used by cyclin inhibitors.	nucleus, cytoplasm	[RK].L.{0,1}[FYLIVMP]
LIG_FHA_1	TTCL TPTA TFGL TTQL TNNL TGSI TFNA TATA TATL TLRL TELL TLQL	21-24 27-30 226-229 279-282 286-289 450-453 493-496 546-549 548-551 550-553 556-559 603-606	FHA domain interaction motif 1, threonine phosphorylation is required	nucleus, cytoplasm, plasma membrane	T..[ILA]
LIG_PP1	LDKAISFS	465-472	LIG_PP1 is a conserved PP1c (protein phosphatase 1 catalytic subunit)- binding motif	nucleus, cytoplasm, protein phosphatase type 1 complex	..[RK].{0,1}[VI][^P][FW].
LIG_TRAF2_1	TQQE AQEE	481-484 487-490	Major TRAF2-binding consensus motif. Members of the tumor necrosis factor receptor (TNFR) superfamily initiate intracellular signaling by recruiting the C-domain of the TNFR-associated factors (TRAFs) through their cytoplasmic tails.	cytoplasm	[PSAT].[QE]E
LIG_WW_4	SLKTPF LSSTPT AAPTPP VTNSPC IPHSPV ATATPW	12-17 24-29 87-92 297-302 326-331 429-434	Class IV WW domains interaction motif; phosphorylation-dependent interaction.	nucleus, cytoplasm	...[ST]P.
MOD_CDK	ATATPWR	429-435	Substrate motif for phosphorylation by CDK	nucleus, cytoplasm, cycloplasmic cyclin-dependent protein kinase holoenzyme complex	...([ST])P.[KR]
MOD_CK1_1	SLCS SNSS SSST SSTS SLKT SSTT STPT SSRT SYTS	3-6 6-9 8-11 9-12 12-15 19-22 26-29 478-481 530-533	CK1 phosphorylation site	nucleus, cytoplasm	S..([ST])
MOD_N-GLC_1	NSS NKT NAT NLT	7-9 40-42 104-106 288-290	Generic motif for N-glycosylation. Shakin-Eshleman et al. showed that Trp, Asp, and Glu are uncommon before the Ser/Thr position. Efficient glycosylation usually occurs when ~60 residues or more separate the glycosylation acceptor site from the C-terminus	extracellular, Golgi apparatus, endoplasmic reticulum	(N)[^P][ST]\|(N)[^P][ST][^P]
MOD_PKA_1	RRGS	338-341	PKA is a protein kinase involved in cell signalling	cytoplasm, cAMP-dependent protein kinase complex	[RK][RK].[ST]
MOD_PKA_2	RGS	339-341	PKA phosphorylation site	cytoplasm	R.([ST])
MOD_SUMO	LKTP PKIN PKPD AKYN AKLD IKYD PKKG	13-16 101-104 116-119 150-153 463-466 497-500 576-579	Motif recognised for modification by SUMO-1	nucleus, PML body	[VILAFP](K).[EDNGP]
TRG_ENDOCYTIC_2	YYKF YLYF YERI YRQL YIRF YTSL YDSV	126-129 210-213 214-217 293-296 504-507 531-534 613-616	Tyrosine-based sorting signal responsible for the interaction with mu subunit of AP (Adaptor Protein) complex	cytoplasm, plasma membrane, clathrin-coated endocytic vesicle	Y..[LMVIF]
TRG_WXXXY/F	WYLYF	209-213	Specific ELM present in Pex5p and binding to Pex13p and Pex14p. Part of the peroxisomal matrix protein import system	peroxisome	W...[FY]

List of excluded ELMs falling inside SMART/PFAM domains.

Matches in this list are only likely to be of interest if they are in surface-exposed loops.
Consult the SMART or PFAM entries for useful links to solved 3D structures.

No Elms excluded by Smart filter.